Bacterial taxon 373153
Protein WP_000075973.1
30S ribosomal protein S9
Streptococcus pneumoniae D39
Gene rpsI, UniProt Q04MF5
>WP_000075973.1|Streptococcus pneumoniae D39|30S ribosomal protein S9
MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.33 | -1.32968558553593 | 8.0e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.12 | -1.12392559622692 | 3.9e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.88 | -0.87909421128085 | 8.7e-10 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)