Bacterial taxon 373153
Protein WP_000087873.1
30S ribosomal protein S7
Streptococcus pneumoniae D39
Gene rpsG, UniProt Q04MH8
>WP_000087873.1|Streptococcus pneumoniae D39|30S ribosomal protein S7
MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYGAFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.78 | -1.77658850368019 | 5.6e-50 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.31 | -1.30605671259171 | 1.8e-27 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.2 | -1.2038439702843 | 1.4e-23 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)