Bacterial taxon 373153
Protein WP_001151785.1
30S ribosomal protein S6
Streptococcus pneumoniae D39
Gene rpsF, UniProt Q04JK8
>WP_001151785.1|Streptococcus pneumoniae D39|30S ribosomal protein S6
MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDAALKEFDRLSKINADILRHMIVKIDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.26 | -2.25637731938214 | 3.9e-47 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.42 | -1.41677136930532 | 2.9e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.14 | -1.14037628236428 | 5.6e-13 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)