Bacterial taxon 373153
Protein WP_000048055.1
30S ribosomal protein S21
Streptococcus pneumoniae D39
Gene rpsU, UniProt Q04JT6
>WP_000048055.1|Streptococcus pneumoniae D39|30S ribosomal protein S21
MSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEVARKRKKF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1 | 1.00420875948308 | 1.3e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.64 | 0.639972957199754 | 0.00094 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.45 | 0.445225306262142 | 0.024 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)