Bacterial taxon 373153
Protein WP_000533766.1
30S ribosomal protein S19
Streptococcus pneumoniae D39
Gene rpsS, UniProt Q04MN2
>WP_000533766.1|Streptococcus pneumoniae D39|30S ribosomal protein S19
MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFIGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.1 | -2.10480993266743 | 1.4e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.93 | -0.929783160925852 | 0.00094 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.79 | -0.791400468327934 | 0.0049 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)