Bacterial taxon 373153
Protein WP_000068664.1
30S ribosomal protein S18
Streptococcus pneumoniae D39
Gene rpsR, UniProt Q04JL0
>WP_000068664.1|Streptococcus pneumoniae D39|30S ribosomal protein S18
MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.6 | -2.60120039576401 | 4.7e-115 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.94 | -1.94384416970887 | 1.4e-64 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.68 | -1.68213634563624 | 8.8e-49 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)