Bacterial taxon 373153
Protein WP_000440801.1
30S ribosomal protein S17
Streptococcus pneumoniae D39
Gene rpsQ, UniProt Q04MM7
>WP_000440801.1|Streptococcus pneumoniae D39|30S ribosomal protein S17
MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKYKAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.06 | -2.06378548624461 | 5.7e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.77 | -0.767341862081676 | 0.026 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.75 | -0.750947239397176 | 0.029 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)