Bacterial taxon 373153
Protein WP_000268761.1
30S ribosomal protein S16
Streptococcus pneumoniae D39
Gene rpsP, UniProt Q04LD0
>WP_000268761.1|Streptococcus pneumoniae D39|30S ribosomal protein S16
MAVKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVAENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKKFHDSKFSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.71 | -2.71482523232529 | 4.7e-108 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.59 | -0.593026232759826 | 2.6e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.58 | -0.580127565648356 | 4.0e-6 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)