Bacterial taxon 373153
Protein WP_001085703.1
30S ribosomal protein S14
Streptococcus pneumoniae D39
Gene rpsN, UniProt Q04MM3
>WP_001085703.1|Streptococcus pneumoniae D39|30S ribosomal protein S14
MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.08 | -2.08475504538875 | 5.9e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.07 | -1.07100866276066 | 0.00053 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.99 | -0.988606879238618 | 0.0015 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)