Bacterial taxon 373153
Protein WP_000090781.1
30S ribosomal protein S13
Streptococcus pneumoniae D39
Gene rpsM, UniProt Q04ML3
>WP_000090781.1|Streptococcus pneumoniae D39|30S ribosomal protein S13
MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRVRDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKNNARTRKGKAVAIAGKKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.68 | -1.6771222717736 | 6.5e-34 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.21 | -1.20863167101137 | 4.0e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.06 | -1.06232166975487 | 2.4e-14 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)