Bacterial taxon 373153
Protein WP_001142332.1
30S ribosomal protein S12
Streptococcus pneumoniae D39
Gene rpsL, UniProt Q04MH9
>WP_001142332.1|Streptococcus pneumoniae D39|30S ribosomal protein S12
MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.8 | -1.80223108587397 | 2.6e-65 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.05 | -1.05067055149883 | 6.0e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.88 | -0.883270829701781 | 1.2e-16 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)