Bacterial taxon 373153
Protein WP_001811821.1
3-isopropylmalate dehydratase small subunit
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLX2
>WP_001811821.1|Streptococcus pneumoniae D39|3-isopropylmalate dehydratase small subunit
MVGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFEIDSKWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.35 | -2.35377125169365 | 6.6e-55 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.41 | -1.41012468943702 | 4.6e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.41 | -1.40706667704372 | 2.6e-20 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)