Bacterial taxon 373153
Protein WP_000565514.1
3-hydroxyacyl-ACP dehydratase FabZ
Streptococcus pneumoniae D39
Gene fabZ, UniProt Q04M51
>WP_000565514.1|Streptococcus pneumoniae D39|3-hydroxyacyl-ACP dehydratase FabZ
MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFNGHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVMTATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.34 | -3.33542361656218 | 2.2e-33 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.88 | -2.88114988571315 | 3.3e-25 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.24 | -2.23588361751928 | 8.7e-16 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)