Bacterial taxon 373153
Protein WP_000695929.1
23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH
Streptococcus pneumoniae D39
Gene rlmH, UniProt Q04HU2
>WP_000695929.1|Streptococcus pneumoniae D39|23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH
MKIKVVTVGKLKEKYLKDGIAEYSKRISRFAKFEMIELSDEKTPDKASESENQKILEIEGQRILSKIADRDFVIVLAIEGKTFFSEEFSKQLEETSIKGFSTLTFIIGGSLGLSSSVKNRANLSVSFGRLTLPHQLMRLVLVEQIYRAFTIQQGFPYHK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.29 | 1.28994098296279 | 2.1e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.02 | 1.01754812734109 | 5.1e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.98 | 0.983247153655091 | 8.2e-5 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)