Bacterial taxon 373153
Protein WP_000801941.1
16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
Streptococcus pneumoniae D39
Gene rsmG, UniProt Q04K39
>WP_000801941.1|Streptococcus pneumoniae D39|16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
MKPETFYNLLAEQNLPLSNQQKEQFERYFELLVEWNEKINLTAITDKEEVYLKHFYDSIAPILQGLIPNETIKLLDIGAGAGFPSLPMKILYPELDVTIIDSLNKRINFLQLLAQELDLNGVHFYHGRAEDFAQDKNFRAQYDFVTARAVARMQVLSELTIPYLKVGGKLLALKASNAPEELLEAKNALNLLFSKVEDNLSYALPNRDPRYITVVEKKKETPNKYPRKAGMPNKRPL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.31 | -1.30794291574688 | 2.6e-31 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.23 | -1.23041810108221 | 1.2e-28 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.19 | -1.19106277510985 | 1.3e-26 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)