Bacterial taxon 216597
Protein WP_000944073.1
thiazole synthase
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene thiG, UniProt A0A0H3NIM3
>WP_000944073.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|thiazole synthase
MLRIADKTFDSHLFTGTGKFASSQLMVEAIRASGSQLVTLAMKRVDLRQHNDAILAPLIEAGVTLLPNTSGAKTAEEAIFAAQLAREALGTHWLKLEIHPDARWLLPDPIETLKAAEALVKQGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLETKAMLEIIIQQSTVPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVMMATAFRLAVEAGVLARQAVPGNRSTYANATSPLTGFLEALA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● -6,64 | -6.6374769770909 | 0,00049 | 26789254 | Bacterial control measured at 37ºC |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●○ -3,35 | -3.34544531880445 | 0,021 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 0,6 ms
(Link to these results)