Bacterial taxon 216597
Protein WP_000999982.1
SPI-2 type III secretion system apparatus protein SsaS
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene ssaS, UniProt A0A0H3NB87
>WP_000999982.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|SPI-2 type III secretion system apparatus protein SsaS
MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAITLMVSYPWLSGILLNYTRQIMLRIGEHG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●● 6.11 | 6.10930025824618 | 7.4e-5 | 26789254 | Bacterial control measured at 37ºC |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● 5.82 | 5.82258469525871 | 0.00027 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 0.7 ms
(Link to these results)