Host taxon 9606
Protein NP_005612.1
protein S100-A12
Homo sapiens
Gene S100A12, UniProt P80511
>NP_005612.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|protein S100-A12
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Monocytic infected cells | 24 h | ●●●○○ 2.53 | 2.52960857424003 | 0.028 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)