Bacterial taxon 216597
Protein WP_001194082.1
flagellar basal body P-ring formation protein FlgA
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene flgA, UniProt A0A0H3NA79
>WP_001194082.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|flagellar basal body P-ring formation protein FlgA
MQTLKRGFAVAALLFSPLTMAQDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMTGSAKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●○ -4 | -3.99832306484192 | 0.00069 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●○ -3.66 | -3.65652917581206 | 0.0099 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 1.7 ms
(Link to these results)