Host taxon 9606
Protein NP_001153166.1
endomucin isoform 2 precursor
Homo sapiens
Gene EMCN, UniProt Q9ULC0
>NP_001153166.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|endomucin isoform 2 precursor
MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKSSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Endotelial infected cells | 24 h | ●●●○○ -2.19 | -2.19015087345816 | 0.00065 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)