Bacterial taxon 216597
Protein WP_001274847.1
DNA-binding transcriptional regulator
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene n/a, UniProt A0A0H3NHI4
>WP_001274847.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|DNA-binding transcriptional regulator
MSAKTKFKSPAFEPIHSAASGLFSVDAIPQETMRSFDTACLSSIKDLQPLEIKALREKLNVSQPVFARYLNTSVSTVQKWESGAKRPSGMSLKLLNVVQKHGLKVLV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●● 4.77 | 4.76610262481847 | 0.024 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)