Host taxon 9606
Protein NP_002984.1
C-X-C motif chemokine 6 precursor
Homo sapiens
Gene CXCL6, UniProt P80162
>NP_002984.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|C-X-C motif chemokine 6 precursor
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Endotelial infected cells | 24 h | ●●●●● 4.69 | 4.68789640744523 | 1.2e-39 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)