Host taxon 9606
Protein NP_005399.1
C-C motif chemokine 13 precursor
Homo sapiens
Gene CCL13, UniProt Q99616
>NP_005399.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|C-C motif chemokine 13 precursor
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Monocytic infected cells | 24 h | ●●●●● -6.42 | -6.41697670705063 | 0.026 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)