Host taxon 9606
Protein NP_001191335.1
arachidonate 5-lipoxygenase-activating protein isoform 2
Homo sapiens
Gene ALOX5AP, UniProt P20292
>NP_001191335.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|arachidonate 5-lipoxygenase-activating protein isoform 2
MLTFNHDAPWHTQKTLKTSEFGKSFGTLGHIGNISHQCWAGCAAGGRAVLSGEPEANMDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Monocytic infected cells | 24 h | ●●○○○ 1.86 | 1.85772174275263 | 0.00092 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)