Host taxon 9606
Protein NP_059109.3
apelin preproprotein
Homo sapiens
Gene APLN, UniProt Q9ULZ1
>NP_059109.3|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|apelin preproprotein
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Endotelial infected cells | 24 h | ●●○○○ -1.41 | -1.40915424026974 | 0.015 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)