Host taxon 10090
Protein NP_081474.1
zinc finger SWIM domain-containing protein 7
Mus musculus
Gene Zswim7, UniProt Q9CWQ2
>NP_081474.1|Pseudomona aeruginosa PA01|zinc finger SWIM domain-containing protein 7
MAVALPEVVEELLSEMAAAVRDSARIPDELLLSLEFVFGSSAIQALDLVDRESVTLISSPSGRRVYQVLGSSGKTYTCLASCHYCSCPAFSFSVLRKSDSLLCKHLLAIYLSQLLRNCQQLHVSDKQLTDLLMEDTRRIKGAAGTWTSKTEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.83 | 1.82535081579444 | 0.0013 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)