Host taxon 10090
Protein NP_081293.4
zinc finger protein family member
Mus musculus
Gene 3300002I08Rik, UniProt Q9CXH3
>NP_081293.4|Pseudomona aeruginosa PA01|zinc finger protein family member
MFRVPPRSPVRRAQASPDMGVVTYDDVHVNFTQEEWALLDPSQKNLYRDVMLETYRNLAAIGYSWEDHNPEEHFQSSRRHGRSGRIHNSSFWMLSYLFLPFVGSDPVLPCCNFGAVLSSNHSAQKLLPLPPSIKVHNLCAAGHPSGM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.68 | -1.68229887223993 | 3.9e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)