Host taxon 10090
Protein NP_001001737.1
zinc finger protein 950 isoform c
Mus musculus
Gene Zfp950, UniProt Q8BL88
>NP_001001737.1|Pseudomona aeruginosa PA01|zinc finger protein 950 isoform c
MDAVTYDEVHVNFTQEEWALLDHSQKSLYRDVMLETYKNLTAIGYNWDDHNIEEHCQSSRRHGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.07 | -1.07168300669823 | 9.0e-9 | 32071273 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)