Host taxon 10090
Protein NP_001280158.1
zinc finger protein 799 isoform 2
Mus musculus
Gene Zfp799, UniProt Q6P5N6
>NP_001280158.1|Pseudomona aeruginosa PA01|zinc finger protein 799 isoform 2
MESVTLEDVAVNFTLEEWTMLNASQKELYKDVMQDTLRNLSYIGNKWEHQNIENEYETLWRKLR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.18 | -1.1766186789207 | 6.9e-5 | 32071273 | |
Retrieved 1 of 3 entries in 2.2 ms
(Link to these results)