Host taxon 10090
Protein NP_080797.1
zinc finger protein 706
Mus musculus
Gene Zfp706, UniProt B2RVQ7
>NP_080797.1|Pseudomona aeruginosa PA01|zinc finger protein 706
MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.06 | -1.05928313149272 | 3.5e-12 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)