Host taxon 10090
Protein NP_001077427.1
zinc finger protein 655 isoform b
Mus musculus
Gene Zfp655, UniProt Q6P8W7
>NP_001077427.1|Pseudomona aeruginosa PA01|zinc finger protein 655 isoform b
MEEVTSQEAAESPRGHFQPLENQSECLSPELRFLQDTDMEQGFSGAPPVPQVPALPHEGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGCLDPVQRELYREVMLENYGNVVSLGILLRLPTTRIHCVNSCPALSHTQASAFSGETLAVLTAGITKRWPRDRLSIGSAHPSTETPFPRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.33 | 1.33164123590703 | 1.2e-24 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)