Host taxon 10090
Protein NP_001078885.1
zinc finger protein 467 isoform b
Mus musculus
Gene Zfp467, UniProt G3X9X3
>NP_001078885.1|Pseudomona aeruginosa PA01|zinc finger protein 467 isoform b
MRETLEALNSLGFSVGQPEMAPQSEPRDGFSNAQEKMSSRGESTLHSCSGHETPGQKEGIHTEQAEAPCMGSQASTPQKAEPAGSVPVLFPLLTWVSWLLRTNWSQGLREH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.41 | -2.40948005071934 | 7.1e-13 | 32071273 | |
Retrieved 1 of 3 entries in 1.3 ms
(Link to these results)