Host taxon 10090
Protein NP_001038183.1
zinc finger protein 41
Mus musculus
Gene Zfp41, UniProt Q02526
>NP_001038183.1|Pseudomona aeruginosa PA01|zinc finger protein 41
MEKPATRKKKSQAPKEEAGAQKATVKGEKTSKGKKATKKPRKPRRPRKEPVLSPEDEAHIFDAFDASFKDDFEGVPVFVPFQRKKPYECGECGRIFKHKTDHIRHQRVHTGEKPFKCDQCGKTFRHSSDVTKHQRIHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYGCEECGKSFAYSSCLIRHRKRHPRKKH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.67 | -2.67159538841836 | 2.3e-8 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)