Host taxon 10090
Protein NP_001158048.1
zinc finger protein 169 isoform b
Mus musculus
Gene Zfp169, UniProt G5E912
>NP_001158048.1|Pseudomona aeruginosa PA01|zinc finger protein 169 isoform b
MAPGLLTTRDKALMAFHDVAVAFSQMEWELLSPAQRILYRDVMLENYSHLVSLGIAFSKPKLITQLEQGAEPWRDGSGCFLDLCPEPRTELEPSLSSPTSADLLRQEALRTGIVGMASAGSFTFIDIGRPSMAINF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.22 | -1.21965943529023 | 6.0e-5 | 32071273 | |
Retrieved 1 of 3 entries in 2.1 ms
(Link to these results)