Host taxon 10090
Protein NP_075755.4
zinc finger protein 120 isoform 2 precursor
Mus musculus
Gene Zfp120, UniProt Q8BZW4
>NP_075755.4|Pseudomona aeruginosa PA01|zinc finger protein 120 isoform 2 precursor
MFLLDVFCVPLLGAGTSGKPRSSDMDIVTYDDVHVNFTWEEWALLDPSQKDLYRDVMLETYRNLAAIGMKEVILKRNFLNLLNMIKTLHIRAILKGMKEFILERNPMKVSNILKTLHITVVSKYREEHML
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.84 | -0.836117759276451 | 0.0057 | 32071273 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)