Host taxon 10090
Protein NP_080291.1
zinc finger matrin-type protein 5 isoform 1
Mus musculus
Gene Zmat5, UniProt Q9CQR5
>NP_080291.1|Pseudomona aeruginosa PA01|zinc finger matrin-type protein 5 isoform 1
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSEQDLQELSVQVEEERRAREWPLETAELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPMQELPPSLRAPPPGGWSVLSKVQWG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.32 | -2.32094382553775 | 0.027 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)