Host taxon 10090
Protein NP_001297676.1
zinc finger HIT domain-containing protein 1 isoform 2
Mus musculus
Gene Znhit1, UniProt Q8R331
>NP_001297676.1|Pseudomona aeruginosa PA01|zinc finger HIT domain-containing protein 1 isoform 2
MVEKKPAVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSASEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.87 | -0.873596602996253 | 0.0093 | 32071273 | |
Retrieved 1 of 3 entries in 0.6 ms
(Link to these results)