Host taxon 10090
Protein NP_077151.3
YY1-associated factor 2
Mus musculus
Gene Yaf2, UniProt Q99LW6
>NP_077151.3|Pseudomona aeruginosa PA01|YY1-associated factor 2
MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDRVEKDKSEKEAASKKNCHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGEASSLNGESH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.78 | 0.77832329221078 | 0.00082 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)