Bacterial taxon 208964
Protein WP_003113551.1
YscB family type III secretion system chaperone PscB
Pseudomona aeruginosa PA01
Gene pscB, UniProt Q9I320
>WP_003113551.1|Pseudomona aeruginosa PA01|YscB family type III secretion system chaperone PscB
MDHLLSGLATRLGQGPFVADRTGSYHLRIDGQSVLLLRQGDDLLLESPLEHAPLDPQRDQQGLLRALLSRVASWSRRYPQAIVLDADGRLLLQARLGLDGLDPERLERALAAQVGLLEALAPELEPLPRGLPPQAPVWRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 4.96 | 4.96130267130636 | 3.9e-215 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)