Host taxon 10090
Protein NP_001116432.1
WASH complex subunit 3 isoform 2
Mus musculus
Gene Washc3, UniProt Q9CR27
>NP_001116432.1|Pseudomona aeruginosa PA01|WASH complex subunit 3 isoform 2
MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSAVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLEDVTVEVSPLNVTAVTNGSHSETTSEQTQNSTQDSGAQESEAPSENVLTVAKDPRYARYLKMVQVGVPVMAIRDKMISEGLDPELLEKPDAPVPNGESERAVEESSDSDSSFSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.29 | -1.29074931662811 | 0.01 | 32071273 | |
Retrieved 1 of 4 entries in 2.1 ms
(Link to these results)