Host taxon 10090
Protein NP_080599.1
WAP four-disulfide core domain protein 2 isoform 1 precursor
Mus musculus
Gene Wfdc2, UniProt Q9DAU7
>NP_080599.1|Pseudomona aeruginosa PA01|WAP four-disulfide core domain protein 2 isoform 1 precursor
MPACRLCLLAAGLLLGLLLFTPISATGTDAEKPGECPQLEPITDCVLECTLDKDCADNRKCCQAGCSSVCSKPNGPSEGELSGTDTKLSETGTTTQSAGLDHTTKPPGGQVSTKPPAVTREGLGVREKQGTCPSVDIPKLGLCEDQCQVDSQCSGNMKCCRNGCGKMACTTPKF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.75 | -0.750929036349576 | 2.5e-22 | 32071273 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)