Host taxon 10090
Protein NP_075884.1
WAP four-disulfide core domain protein 1 precursor
Mus musculus
Gene Wfdc1, UniProt Q9ESH5
>NP_075884.1|Pseudomona aeruginosa PA01|WAP four-disulfide core domain protein 1 precursor
MGNCGRKVLRALSFLLLLGSSSAQGTWEAMLPARLAEKSRAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAETCSTTEDGAEPLLCPSGYECHILQPGDEAQGIPNHGQCVKQRRQAEGRVLRQRLHKEYPEGDSKNVAEPGKGQQRHFP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.61 | -1.60959793841905 | 6.7e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)