Host taxon 10090
Protein NP_849257.1
vimentin-type intermediate filament-associated coiled-coil protein isoform 1
Mus musculus
Gene Vmac, UniProt Q8BP01
>NP_849257.1|Pseudomona aeruginosa PA01|vimentin-type intermediate filament-associated coiled-coil protein isoform 1
MSAPPPLQIREANAHLAAVHRRAAELERRLLAAERTIGAQAERLACHDQHLRAALDELGRAKDREISALQEQLLSSEATVRSLQAAVDQRDQMIQQLQPRADLLQDITRHRPPLAALLATLEEAEELGPLPASHSHRAQLLPDGPGPPLGNNMGKEEGQDDQDDQQPAVFGTTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.86 | -1.85769432332712 | 5.3e-9 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)