Host taxon 10090
Protein NP_001074026.1
vesicle-associated membrane protein 1 isoform b
Mus musculus
Gene Vamp1, UniProt Q62442
>NP_001074026.1|Pseudomona aeruginosa PA01|vesicle-associated membrane protein 1 isoform b
MSAPAQPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVSKYR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.61 | -2.60511668730941 | 2.8e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)