Host taxon 10090
Protein NP_663487.1
vesicle transport protein SFT2B
Mus musculus
Gene Sft2d2, UniProt Q8VD57
>NP_663487.1|Pseudomona aeruginosa PA01|vesicle transport protein SFT2B
MDKLKKVLSGQDTEDRSGLSEVVEASSLSWGTRIKGFIACFALGILCSVLGTLLLWVPRKGLGLFAVFYTLGNIMSIGSTVFLMGPLKQLKRMFEPTRLIATILVLLCFALTLCSAFLWNKGLALIFCILQSLALTWYSLSYIPYARDAVKKCFAVCLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.39 | 0.394255839628066 | 5.3e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)