Host taxon 10090
Protein NP_291046.1
vacuolar-sorting protein SNF8 isoform 1
Mus musculus
Gene Snf8, UniProt Q9CZ28
>NP_291046.1|Pseudomona aeruginosa PA01|vacuolar-sorting protein SNF8 isoform 1
MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKTSLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEISAEEAKEAFP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.76 | 0.755459557284907 | 0.006 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)