Host taxon 10090
Protein NP_598525.1
V-type proton ATPase subunit e 2 isoform 1
Mus musculus
Gene Atp6v0e2, UniProt Q91XE7
>NP_598525.1|Pseudomona aeruginosa PA01|V-type proton ATPase subunit e 2 isoform 1
MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.35 | -1.34971511622516 | 1.4e-7 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)