Host taxon 10090
Protein NP_001153044.1
V-type immunoglobulin domain-containing suppressor of T-cell activation isoform 2 precursor
Mus musculus
Gene Vsir, UniProt Q9D659
>NP_001153044.1|Pseudomona aeruginosa PA01|V-type immunoglobulin domain-containing suppressor of T-cell activation isoform 2 precursor
MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.48 | 0.484641628424293 | 8.1e-6 | 32071273 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)