Host taxon 10090
Protein NP_065264.2
V-set and immunoglobulin domain-containing protein 2 precursor
Mus musculus
Gene Vsig2, UniProt Q9Z109
>NP_065264.2|Pseudomona aeruginosa PA01|V-set and immunoglobulin domain-containing protein 2 precursor
MAWPLVGAFLCGHLLGFVCLSGLAVEVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLSVTDSSEGRVAGTLIGVLLGVLLLSVAAFCLIRFQKERKKEPKETYGGSDLREDATAPGVFEQASMRADHSKELLEKSPCASTMTTTKSKLSMVV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.47 | 1.47495977636239 | 1.5e-13 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)