Host taxon 10090
Protein NP_035811.1
uteroglobin precursor
Mus musculus
Gene Scgb1a1, UniProt Q06318
>NP_035811.1|Pseudomona aeruginosa PA01|uteroglobin precursor
MKIAITITVVMLSICCSSASSDICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.76 | 0.761954848915913 | 7.0e-121 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)